PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00349.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 296aa    MW: 32879 Da    PI: 8.7004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00349.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.7e-08754345
                             SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                              W+ eE++ + +a++++  +      +W++  + ++ ++tl+q+k ++q
  Rsa1.0_00349.1_g00011.1  7 TWSREEEKSFENAIAMHCVEeeiteeQWSKMVSVVP-TKTLEQVKKHYQ 54
                             6****************999****************.***********9 PP

2Myb_DNA-binding42.31.7e-13123167347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Rsa1.0_00349.1_g00011.1 123 PWTEEEHRLFLLGLEKFGKGDWRSISRNFVITRTPTQVASHAQKY 167
                              7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.792361IPR017884SANT domain
SMARTSM007171.4E-4459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-4658IPR009057Homeodomain-like
PfamPF002497.5E-6754IPR001005SANT/Myb domain
CDDcd001679.37E-7757No hitNo description
SuperFamilySSF466891.72E-8864IPR009057Homeodomain-like
PROSITE profilePS5129417.271116172IPR017930Myb domain
SuperFamilySSF466892.73E-17118173IPR009057Homeodomain-like
SMARTSM007171.9E-11120170IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.0E-17120170IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-11121166IPR009057Homeodomain-like
CDDcd001676.85E-11123168No hitNo description
PfamPF002494.4E-12123167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MESVAVTWSR EEEKSFENAI AMHCVEEEIT EEQWSKMVSV VPTKTLEQVK KHYQILLEDV  60
KAIENGQVPL PRYHRAGDEA APENRDCHSS GSSEKKPNHG VPGTNGGGRS SSRHEQERRK  120
GIPWTEEEHR LFLLGLEKFG KGDWRSISRN FVITRTPTQV ASHAQKYFIR LNSMNRDRRR  180
SSIHDITSLN NQAPAVTGQQ QQQQVAKHRA AQPQPQPQQP HHPGATMAGL GMYGGAPLGQ  240
PIMAPPDHMG SAVGTPVMLP PPMGTHHHHL GVAPYAVPAY PVPQIPQQHP APSTMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-138771177RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869061e-152AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195281e-152AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248621e-152BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640827.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078IHL30.0A0A078IHL3_BRANA; BnaCnng16520D protein
TrEMBLA0A0D3CPE30.0A0A0D3CPE3_BRAOL; Uncharacterized protein
STRINGBra018772.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-121MYB family protein